PhoScan



Input single protein sequence:

please inpute your protein sequence here

Example protein sequence:
PKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL



Prediction by log-odds ratio Prediction by consensus sequences

Choose protein kinase families:

Choose stringency level:
(High = more selective, Low = more sensitive)

Choose protein kinase families:

Download:
    The following are PhoScan packages developed for local machine installation based on different platform. The users can choose to download the package according to their platform conditions.
User Manual      This is a package developed for linux platform. The service background engine has been compiled to distributable execute format for local install. Please follow the instructions in the package.
PhoScan Linux Edition
User Manual      This is a package developed for windows platform. Please follow the instructions in the package to install the PhoScan on local machine.
PhoScan Windows Edition

Contact: li-tt03@mails.tsinghua.edu.cn