PhoScan
Service


PhoScan

PhoScan is free for any acadmic use. please contact li-tt03@mails.tsinghua.edu.cn for more information.

 

The tool of PhoScan could be downloaded for both Windows and Linux platforms.



Service


please inpute your protein sequence here (Single protein):

Example protein sequence:

PKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDD NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Prediction by log-odds ratio Prediction by consensus sequences
Choose protein kinase families:

Choose stringency level:
(High = more selective, Low = more sensitive)
Choose protein kinase families: